PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g003050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 703aa    MW: 77116.9 Da    PI: 6.8865
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g003050.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.9e-094044411954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Sopen01g003050.1 404 FEHflHPYPKDSDKMMLAKQTGLTRSQVSNWFINARVR 441
                       554459******************************88 PP

2BELL113.41.2e-36268339172
              BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       erqe+q+kkakL+++l+eV++rY++y++q+q vi+  e++ag+gsak Yt+lAl++iS++FrcLkdai++qi
  Sopen01g003050.1 268 ERQEIQMKKAKLVNMLDEVEQRYRHYHHQMQSVINWLEQAAGIGSAKTYTALALQTISKQFRCLKDAIIGQI 339
                       79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.5E-54192337IPR006563POX domain
PfamPF075264.7E-46199335IPR006563POX domain
PROSITE profilePS5007112.147382445IPR001356Homeobox domain
CDDcd000866.05E-13385446No hitNo description
SMARTSM003899.7E-10385449IPR001356Homeobox domain
SuperFamilySSF466895.99E-17386451IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28388451IPR009057Homeodomain-like
PfamPF059203.8E-18402441IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 703 aa     Download sequence    Send to blast
MASYFHGNSE IQEGNDGLQT LILMNPGYVG FSEAQHHHAP PPPPQGGGGS SNIVFFNSNP  60
LGNSINLSHA PPPPPSQQQQ FVGIPLATAA FTAPSQDSGN NNNHHNHNNE SALHGFLARS  120
SPYGFYNPAN DITAAREVTR AHHQQQQGLS LSLSSSQQPS FGSFTAAREI ASSPTGSASA  180
SGIQQQQQQQ QQSICSVPLS SKYMKAAQEL LDEVVNVGKS MKSSNSTEVV VYNDVKKSKN  240
MVDMDGRLDG VGPAEKDGAP TNELSTAERQ EIQMKKAKLV NMLDEVEQRY RHYHHQMQSV  300
INWLEQAAGI GSAKTYTALA LQTISKQFRC LKDAIIGQIR SASKTLGEED SLGGKIEGSR  360
LKFVDNQLRQ QRALQQLGMI QHNAWRPQRG LPERAVSVLR AWLFEHFLHP YPKDSDKMML  420
AKQTGLTRSQ VSNWFINARV RLWKPMVEEM YLEEIKEHEQ NALGQEKTSK VGEQNEDSTT  480
SRSIATQDKS PGSDSQKQDN PASSIPMSNA TSIPPIGMNI RNQSAGFNLI GSPDIESINV  540
TQGSPKKPRS NEMLQHSPNS IPSINMDVKP NEEQMSMKFG DDRQDRDGFS LMGGPMNFMG  600
GFGAYPIGEI ARFSTEQFSA PYSTSGTVSL TLGLPHNENL SMSATHHSFL PIPTQNVQIG  660
EPNHEFGSLN TPTSAHSTSN VYENFNIQNR KRFAAPLLPD FVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16391449563Homeobox protein Meis2
3k2a_B3e-16391449563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015062369.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-154BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLK4ASS30.0K4ASS3_SOLLC; Uncharacterized protein
STRINGSolyc01g007070.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-123BEL1-like homeodomain 1